Multiple structure alignment

1gkea.atm 1tfpa.atm 2pabb.atm

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120  123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|123456789|12  SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPF-HEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN  --CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHE-YADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS----  --CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEQFVEGIYKVEIDTKSYWKALGISPF-HEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVT----

Download the alignment in fasta format
Columns in green are common core regions (i.e., columns with no gaps and the maximum pairwise residue distance < 4Å).

Metrics of the alignment

Visualization of the alignment

    Total 3 input structures:      1gkea.atm 1tfpa.atm 2pabb.atm

    Click on the corresponding buttons to show different regions (the default show is for the common core region).

    

    






    Download the superimposed structure file

Reference

R. Dong, S. Pan, Z. Peng, Y. Zhang and J. Yang, mTM-align: a server for fast protein structure database searching and multiple protein structure alignment, submitted, 2017.

R. Dong, Z. Peng, Y. Zhang and J. Yang, mTM-align: an algorithm for fast and accurate multiple protein structure alignment, Bioinformatics, 2017 (in press).