COACH-D results for job CH031705 (example)

Input: Submitted protein   Submitted ligand           Output: Download all results
Predicted complex structure
spin
Current complex information
Binding sites

Rank: 1

C-Score: 0.71

TM-score: 1.00

Cluster size: 174

Protein template: 1A6W_1

Predicted binding sites: A: Y33,W92,W97
B: W33,H35,R50,K59,Y99,Y101,S105

Poseu

User submitted ligand: Submitted ligand

Docking energy: -4.1

Poset

Ligand template: NIP

Docking energy: -6.9

Sequence

>Chain A
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
>Chain B
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSS


Rank Poseu Poset C-Score Cluster size P template L template TM-score Predicted binding residues
1 0.71 174 1A6W_1 NIP 1.00 A: Y33,W92,W97
B: W33,H35,R50,K59,Y99,Y101,S105
2 0.68 109 1NC2_2 DOE 0.95 A: Y33,W92
B: W33,R50,D52,G57,K59,Y99,Y101,S105
3 0.67 89 5XCR_2 PEPTIDE 0.96 A: Y33,N35,W92
B: S31,Y32,W33,H35,R50,Y99,D100,S105,Y106
4 0.66 77 2OP4_1 EDO 0.97 A: V37,A90,W92,W97
B: H35,A97,Y99,D108,W110
5 0.62 59 1YED_2 PNB 0.92 A: Y33,N35,A90,W92,W97,F99
B: H35,V37,R50,A97,Y99,Y101,S105
Download the detailed prediction summary.    Download the templates clustering results.

   Summary of template ligands

Rank Ligand Frequency PDB template Visualizaiton
1 III 24 2ZPK_1, 2ZPK_2, 3QO0_1,
4ONG_1, 5XCR_1, 5ZIA_1,
5ZIA_3, 5ZIA_4, 5ZIA_5,
5ZIA_6, 6CDM_1, 6CDM_2,
6DC8_1, 6DCA_1, 6DCA_4,
6H06_4, 6LZ4_1, 6LZ4_2,
7BXV_1, 7RLW_2

Peptides

2 AZN 12 1OAR_1, 1OAR_2, 1OAR_3,
1OAR_4
3 HAN 9 1Y0L_1, 1Y0L_2, 1Y0L_3,
1Y0L_4, 1Y18_1, 1Y18_2,
1Y18_3, 1Y18_4
Others k-mer(8), OHM(8), TNS(6), DNF(6), FUR(6), 6MD(6), ANO(5), OOX(5), STR(5), ANF(4), ANQ(4), NUC(4), TAA(4), ECO(4), HOP(3),
2M9(3), NIP(3), TES(3), NPC(3), MOI(3), 1PC(3), NPA(3), NCT(2), HAL(2), DIK(2), AB0(2), EOT(2), TCI(2), OOW(2), DOF(2),
SIH(1), XPG(1), MBT(1), T44(1), ON5(1), P4S(1), GAS(1), O2W(1), P0M(1), P2E(1), QI9(1), PME(1)

Reference

  • Q Wu, Z Peng, Y Zhang, J Yang, COACH-D: improved protein-ligand binding site prediction with refined ligand-binding poses through molecular docking, Nucleic Acids Research, 46: W438–W442 (2018).