COACH-D results for job CH031705

COACH-D results for job CH031705 (example)

Input: Submitted protein Submitted ligand Output: Download all results

Predicted complex structure

spin

Current complex information

Binding sites

Rank: 1

CScore: 0.71

TM-score: 1.00

Cluster size: 174

Protein template: 1A6W_1

Predicted binding sites: A: Y33,W92,W97
B: W33,H35,R50,K59,Y99,Y101,S105

Pose^u

User submitted ligand: Submitted ligand

Docking energy: -4.1

Pose^t

Ligand template: NIP

Docking energy: -6.9

Sequence

>Chain A
AVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLE
>Chain B
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSS

Rank	CScore	Cluster size	P template	L template	TM-score	Predicted binding residues
1	0.71	174	1A6W_1	NIP	1.00	A: Y33,W92,W97 B: W33,H35,R50,K59,Y99,Y101,S105
2	0.68	109	1NC2_2	DOE	0.95	A: Y33,W92 B: W33,R50,D52,G57,K59,Y99,Y101,S105
3	0.67	89	5XCR_2	PEPTIDE	0.96	A: Y33,N35,W92 B: S31,Y32,W33,H35,R50,Y99,D100,S105,Y106
4	0.66	77	2OP4_1	EDO	0.97	A: V37,A90,W92,W97 B: H35,A97,Y99,D108,W110
5	0.62	59	1YED_2	PNB	0.92	A: Y33,N35,A90,W92,W97,F99 B: H35,V37,R50,A97,Y99,Y101,S105

Download the detailed prediction summary. Download the templates clustering results.

Summary of template ligands

Rank	Ligand	Frequency	PDB template	Visualizaiton
1	III	24	2ZPK_1, 2ZPK_2, 3QO0_1, 4ONG_1, 5XCR_1, 5ZIA_1, 5ZIA_3, 5ZIA_4, 5ZIA_5, 5ZIA_6, 6CDM_1, 6CDM_2, 6DC8_1, 6DCA_1, 6DCA_4, 6H06_4, 6LZ4_1, 6LZ4_2, 7BXV_1, 7RLW_2	Peptides
2	AZN	12	1OAR_1, 1OAR_2, 1OAR_3, 1OAR_4
3	HAN	9	1Y0L_1, 1Y0L_2, 1Y0L_3, 1Y0L_4, 1Y18_1, 1Y18_2, 1Y18_3, 1Y18_4
Others	k-mer(8), OHM(8), TNS(6), DNF(6), FUR(6), 6MD(6), ANO(5), OOX(5), STR(5), ANF(4), ANQ(4), NUC(4), TAA(4), ECO(4), HOP(3), 2M9(3), NIP(3), TES(3), NPC(3), MOI(3), 1PC(3), NPA(3), NCT(2), HAL(2), DIK(2), AB0(2), EOT(2), TCI(2), OOW(2), DOF(2), SIH(1), XPG(1), MBT(1), T44(1), ON5(1), P4S(1), GAS(1), O2W(1), P0M(1), P2E(1), QI9(1), PME(1)

Reference

Q Wu, Z Peng, Y Zhang, J Yang, COACH-D: improved protein-ligand binding site prediction with refined ligand-binding poses through molecular docking, Nucleic Acids Research, 46: W438–W442 (2018).